Protein ZmIAA24
ZmIAA24 is a protein in the Aux/IAA family.
Information
Coreg Name: ZmIAA24
Species: Maize
Coreg Family: Aux/IAA
Gene Name(Synonym): IAA31
Uniprot ID: A0A1D6PDQ1

Protein ZmIAA24

ZmIAA24 is a protein in the Aux/IAA family. NOTE the "Uniprot ID" shown on the right is a placeholder for testing. The interactive structure shown is based on that id.

Protein-DNA Interactions

Interactions where ZmIAA24 is the regulator


There are no protein-dna interactions that fit this criteria.

Interactions where ZmIAA24 is the target


There are no protein-dna interactions that fit this criteria.

GRMZM2G149449_T01 from maize genome v3


Related TFome: pUT4600

Amino Acid Sequence
Copy to clipboard

MAGYGDDGVDLTELTLGPPGVNARKARRARKNGQQPSSSAMTMQAFVKVSMDGTPYLRKVDVAAYDDYGELVEALNELFC
CCSIGLMDGYGEWEHAVVYEDGDGDWMLVGDVPWE

MAGYGDDGVDLTELTLGPPGVNARKARRARKNGQQPSSSAMTMQAFVKVSMDGTPYLRKVDVAAYDDYGELVEALNELFC
CCSIGLMDGYGEWEHAVVYEDGDGDWMLVGDVPWE

Secondary Structure Color Code
BEND region with high backbone curvature without specific hydrogen bonding
HELX_LH_PP_P left-handed polyproline helix
HELX_RH_3T_P right-handed 3-10 helix
HELX_RH_AL_P right-handed alpha helix
HELX_RH_PI_P right-handed pi helix
STRN beta strand
TURN_TY1_P type I turn
UNDETERMINED no data available

Nucleotide Sequence
Copy to clipboard
     
Expand

AGTTTCAGTTCCACCCTCACGCTTC...


Copyright © 2023 Grassius.org | Last updated: 2023-06-26